Entamoeba histolytica: EHI_140190 Help Entry EHI_140190        CDS       T00238                                  Symbol 8.t00018 Name (RefSeq) Rho family GTPase   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ehi  Entamoeba histolytica Pathway ehi04145   Phagosome ehi04148   Efferocytosis ehi04620   Toll-like receptor signaling pathway ehi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ehi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EHI_140190 (8.t00018)    04148 Efferocytosis     EHI_140190 (8.t00018)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     EHI_140190 (8.t00018)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     EHI_140190 (8.t00018)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehi04131]     EHI_140190 (8.t00018)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ehi04147]     EHI_140190 (8.t00018)    04031 GTP-binding proteins [BR:ehi04031]     EHI_140190 (8.t00018) Membrane trafficking [BR:ehi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     EHI_140190 (8.t00018)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     EHI_140190 (8.t00018)   Macropinocytosis    Ras GTPases     EHI_140190 (8.t00018)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     EHI_140190 (8.t00018) Exosome [BR:ehi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EHI_140190 (8.t00018)   Exosomal proteins of other body fluids (saliva and urine)    EHI_140190 (8.t00018)   Exosomal proteins of colorectal cancer cells    EHI_140190 (8.t00018)   Exosomal proteins of bladder cancer cells    EHI_140190 (8.t00018) GTP-binding proteins [BR:ehi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     EHI_140190 (8.t00018) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf EpCAM_N Motif Other DBs NCBI-GeneID:  3411063 NCBI-ProteinID:  XP_656745 UniProt:  Q24815 LinkDB All DBs AA seq 193 aa AA seqDB search MQSVKCVIVGDGAVGKTCLLVSYTTNAFPTEYVPTVFDNYSATVMVDSRPINLGLWDTAG QEDYDRIRPLSYPQTDVFLLCFSVVSPPSFENISSKWKPEVSHHCPNAPCLLIGTKIDIR DEQTQTNKTCDKKIEPITSEQGEAKCKDIGALKYIECSALTQKNLRYVFDEAVRAVININ KKEKIKRKSCLIF NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcaatcagttaagtgtgttattgttggtgatggtgcagttggaaaaacttgtcttctt gtttcatacactacaaatgcttttccaacagaatatgtaccaactgtgtttgataattat tctgcaactgttatggttgattctagaccaattaaccttggactttgggatactgctgga caagaagattatgacagaattcgtccattgtcatacccacaaacagatgtctttttgtta tgcttttctgttgtttcaccaccttcatttgaaaatatttcatctaaatggaaaccagaa gtttctcatcattgtccaaatgctccatgtttattgattggtaccaaaattgatattaga gatgaacaaacacaaacaaacaaaacatgtgacaagaaaattgaacctataacatctgaa caaggtgaagcaaaatgtaaagatattggagctcttaagtatatagaatgttcagcatta actcaaaagaatttaagatatgtttttgatgaagctgttcgtgcagtaattaacatcaat aaaaaagagaaaataaagagaaagagttgccttattttttaa

DBGET integrated database retrieval system