Entamoeba histolytica: EHI_170340 Help Entry EHI_170340        CDS       T00238                                  Symbol 163.t00018 Name (RefSeq) 60S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ehi  Entamoeba histolytica Pathway ehi03010   Ribosome ehi04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ehi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     EHI_170340 (163.t00018)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EHI_170340 (163.t00018)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ehi03011]     EHI_170340 (163.t00018)    04121 Ubiquitin system [BR:ehi04121]     EHI_170340 (163.t00018) Ribosome [BR:ehi03011]  Ribosomal proteins   Eukaryotes    Large subunit     EHI_170340 (163.t00018)   Archaea     EHI_170340 (163.t00018) Ubiquitin system [BR:ehi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    EHI_170340 (163.t00018) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Motif Other DBs NCBI-GeneID:  3405783 NCBI-ProteinID:  XP_651480 UniProt:  C4LV09 LinkDB All DBs AA seq 56 aa AA seqDB search MGIEPALEAIARKYNCDKMICRRCYARLPLRATTCRKKKCGHSGDLRPKKKIQSKK NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgggtattgaaccagcattagaagctattgctagaaaatataattgtgacaaaatgatt tgcagaagatgttatgctagacttcctctcagagctactacttgtagaaaaaagaagtgt ggacattcaggagatcttagaccaaagaagaagatccaatcaaagaaataa

DBGET integrated database retrieval system