Ehrlichia sp. JZT12: K6025_02215 Help Entry K6025_02215       CDS       T10635                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ehj  Ehrlichia sp. JZT12 Brite KEGG Orthology (KO) [BR:ehj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ehj03032]     K6025_02215    03036 Chromosome and associated proteins [BR:ehj03036]     K6025_02215    03400 DNA repair and recombination proteins [BR:ehj03400]     K6025_02215 DNA replication proteins [BR:ehj03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     K6025_02215 Chromosome and associated proteins [BR:ehj03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     K6025_02215 DNA repair and recombination proteins [BR:ehj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       K6025_02215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Motif Other DBs NCBI-ProteinID:  WDM85642 LinkDB All DBs Position complement(578209..578493) Genome browser AA seq 94 aa AA seqDB search MSKGMVVRTLMAELGLTKKISSQAYDLVMLSIQNALETSHLIRLHNVGTLHVIQCAEKKY HNPKTGKLETLAPKKRVRFRSSKKLSNAINPLEN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgagtaagggtatggtagtaagaacacttatggcagagttaggattaacaaaaaagata tcaagtcaagcttatgatctagtaatgcttagtatacaaaatgcattggaaacttctcat ctgattaggctacacaatgttggaacattacacgtgattcaatgtgcagaaaagaaatac cacaaccctaaaactggaaagctagaaacattagcccctaagaaaagagtaagatttaga tcaagtaaaaaattatcaaatgctattaatcccttagaaaattag

DBGET integrated database retrieval system