Enterobacter hormaechei CAV1176: AB284_16715 Help Entry AB284_16715       CDS       T04593                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ehm  Enterobacter hormaechei CAV1176 Pathway ehm01100   Metabolic pathways ehm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ehm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB284_16715    00074 Mycolic acid biosynthesis     AB284_16715   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB284_16715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  ANS18202 UniProt:  A0A155BMU0 LinkDB All DBs Position complement(3293902..3294138) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttcctttgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system