Enterobacter hormaechei CAV1176: AB284_18560 Help Entry AB284_18560       CDS       T04593                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ehm  Enterobacter hormaechei CAV1176 Pathway ehm00190   Oxidative phosphorylation ehm01100   Metabolic pathways ehm02020   Two-component system Module ehm_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ehm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AB284_18560  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AB284_18560 Enzymes [BR:ehm01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AB284_18560 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ANS18545 UniProt:  A0ACG2ZMN3 LinkDB All DBs Position complement(3681834..3681947) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGVITALALEHVEATKAGEEKH NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattttagggacgcttcttgcctgtgcgtttggtgtcatcact gccctggcgcttgagcatgtagaagcgaccaaagcaggtgaagaaaagcactaa

DBGET integrated database retrieval system