Edwardsiella hoshinae: A9798_06485 Help Entry A9798_06485       CDS       T04508                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eho  Edwardsiella hoshinae Pathway eho01100   Metabolic pathways eho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9798_06485    00074 Mycolic acid biosynthesis     A9798_06485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9798_06485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AOV96637 UniProt:  A0A376DEU5 LinkDB All DBs Position 1455779..1456015 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVVNSASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYIEAANK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgaacagctgggtgttaaagaa gacgaagttgtgaattcagcttctttcgttgacgatctgggtgctgattctcttgacacc gttgaactggttatggctctggaagaagagtttgatactgagattccggacgaagaagca gagaagatcaccactgttcaggctgctatcgactacatcgaagctgcaaacaagtaa

DBGET integrated database retrieval system