Eurypyga helias (sunbittern): 104504914 Help Entry 104504914         CDS       T08356                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04010   MAPK signaling pathway ehs04012   ErbB signaling pathway ehs04068   FoxO signaling pathway ehs04137   Mitophagy - animal ehs04140   Autophagy - animal ehs04150   mTOR signaling pathway ehs04210   Apoptosis ehs04218   Cellular senescence ehs04370   VEGF signaling pathway ehs04371   Apelin signaling pathway ehs04540   Gap junction ehs04625   C-type lectin receptor signaling pathway ehs04810   Regulation of actin cytoskeleton ehs04910   Insulin signaling pathway ehs04912   GnRH signaling pathway ehs04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ehs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104504914    04012 ErbB signaling pathway     104504914    04370 VEGF signaling pathway     104504914    04371 Apelin signaling pathway     104504914    04068 FoxO signaling pathway     104504914    04150 mTOR signaling pathway     104504914  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104504914    04137 Mitophagy - animal     104504914   09143 Cell growth and death    04210 Apoptosis     104504914    04218 Cellular senescence     104504914   09144 Cellular community - eukaryotes    04540 Gap junction     104504914   09142 Cell motility    04810 Regulation of actin cytoskeleton     104504914  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104504914   09152 Endocrine system    04910 Insulin signaling pathway     104504914    04912 GnRH signaling pathway     104504914    04916 Melanogenesis     104504914  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehs04131]     104504914   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ehs04147]     104504914    04031 GTP-binding proteins [BR:ehs04031]     104504914 Membrane trafficking [BR:ehs04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104504914  Endocytosis   Macropinocytosis    Ras GTPases     104504914 Exosome [BR:ehs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104504914   Exosomal proteins of other body fluids (saliva and urine)    104504914   Exosomal proteins of breast cancer cells    104504914   Exosomal proteins of colorectal cancer cells    104504914 GTP-binding proteins [BR:ehs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104504914 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 Motif Other DBs NCBI-GeneID:  104504914 NCBI-ProteinID:  XP_010151195 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search RKQAAPCFSCKIRLCVLQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFL CVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGI PFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQGCMGLSCTVM NT seq 514 nt NT seq  +upstreamnt  +downstreamnt gcggaagcaagcagcaccgtgtttctcatgtaaaattcgcttgtgtgttttgcaggattc ctataggaagcaggttgttattgacggagagacgtgcttgttagatatcctggacacagc ggggcaggaggagtacagtgccatgcgtgatcagtacatgagaaccggggaaggattcct ctgtgtttttgccattaacaacagtaaatcgtttgccgatattaacctttacagagaaca gatcaagagagtgaaagactcggatgacgtgccgatggtgctcgttgggaataagtgtga tttgcccacgagaacagtagacacaaaacaggctcaagaattagcaaagagctatggaat ccccttcatagagacgtctgctaaaacaagacagggcgtggaagatgctttttacacgct ggtgagagagatccggcagtaccggatgaagaagctgaacagcagcgaagacgggaacca gggctgtatgggattgtcctgcactgtgatgtga

DBGET integrated database retrieval system