Eurypyga helias (sunbittern): 104506517 Help Entry 104506517         CDS       T08356                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04810   Regulation of actin cytoskeleton ehs05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ehs00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104506517 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104506517 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehs04131]     104506517 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ehs04812]     104506517 (PFN4)    04147 Exosome [BR:ehs04147]     104506517 (PFN4) Membrane trafficking [BR:ehs04131]  Others   Actin-binding proteins    Others     104506517 (PFN4) Cytoskeleton proteins [BR:ehs04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104506517 (PFN4) Exosome [BR:ehs04147]  Exosomal proteins   Proteins found in most exosomes    104506517 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104506517 NCBI-ProteinID:  XP_010145791 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search TKHLENAAIIDIKERQVCASTFGFNPDGGLIVVKAKTFILVATYRVGMYPSVCVEAVEKL GEGNGCSCVPACQHFVG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt acaaagcatttggaaaatgcagctatcattgacataaaggaaagacaagtctgtgcatca acctttggctttaatccagacggaggcctgatagttgtgaaggcaaagactttcatcctg gttgctacttacagagtgggcatgtatcccagcgtgtgcgtggaagctgtggagaaactg ggagagggaaacggttgtagctgtgtgcctgcatgccagcattttgttggttag

DBGET integrated database retrieval system