Eurypyga helias (sunbittern): 104507131 Help Entry 104507131         CDS       T08356                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04068   FoxO signaling pathway ehs04136   Autophagy - other ehs04140   Autophagy - animal ehs04621   NOD-like receptor signaling pathway ehs04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ehs00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104507131 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104507131 (ATG12)    04136 Autophagy - other     104507131 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104507131 (ATG12)    04622 RIG-I-like receptor signaling pathway     104507131 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehs04131]     104507131 (ATG12)    04121 Ubiquitin system [BR:ehs04121]     104507131 (ATG12)    03029 Mitochondrial biogenesis [BR:ehs03029]     104507131 (ATG12) Membrane trafficking [BR:ehs04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     104507131 (ATG12) Ubiquitin system [BR:ehs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    104507131 (ATG12) Mitochondrial biogenesis [BR:ehs03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     104507131 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  104507131 NCBI-ProteinID:  XP_010146614 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search PIMKTKKWAVERTRTIQGLIDFIKKFLKLMASEQLFIYVNQSFAPSPDQEVGTLYECFGS DGKLVLHYCKTQAWG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt cccatcatgaagaccaagaagtgggccgtggagcgcacccgcaccatccagggcctcatt gacttcatcaagaagttcctcaagctaatggcctccgagcagctgttcatatacgtaaac cagtcttttgctccatctccagaccaagaagttggaaccctctatgagtgttttggaagt gatggcaagcttgtactgcactattgcaaaactcaggcatggggatga

DBGET integrated database retrieval system