Eurypyga helias (sunbittern): 104510208 Help Entry 104510208         CDS       T08356                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04060   Cytokine-cytokine receptor interaction ehs04218   Cellular senescence ehs04620   Toll-like receptor signaling pathway ehs04621   NOD-like receptor signaling pathway ehs04622   RIG-I-like receptor signaling pathway ehs05132   Salmonella infection ehs05164   Influenza A Brite KEGG Orthology (KO) [BR:ehs00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104510208  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104510208  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104510208    04621 NOD-like receptor signaling pathway     104510208    04622 RIG-I-like receptor signaling pathway     104510208  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104510208   09171 Infectious disease: bacterial    05132 Salmonella infection     104510208  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ehs04052]     104510208    00536 Glycosaminoglycan binding proteins [BR:ehs00536]     104510208 Cytokines and neuropeptides [BR:ehs04052]  Cytokines   Chemokines    104510208 Glycosaminoglycan binding proteins [BR:ehs00536]  Heparan sulfate / Heparin   Chemokines    104510208 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104510208 NCBI-ProteinID:  XP_010150681 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MMGKAVAAVLTLLLISAVGTKGKALPRSAIELRCQCVGTHSKFIHPKFIHNVNLIPSGPH CKNVEVIATLTDGREVCLEPTAPWVKLIIKAILDKANPKPETVS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgatgggcaaggctgtggctgctgtcctgactcttctcctcatctcagcggttggtaca aaaggtaaggccctgcctcgctcagcgattgaactccggtgccagtgcgtaggcacccac tccaagttcatccatcccaagttcattcataacgtgaacctcatccccagcggacctcac tgcaagaacgttgaagtcatagctaccctgacagacggcagagaagtgtgcctggagccc actgctccctgggtgaagctgatcatcaaggcaattctggacaaggcaaaccccaaacct gagacagtttcttaa

DBGET integrated database retrieval system