Eurypyga helias (sunbittern): 104510301 Help Entry 104510301         CDS       T08356                                  Symbol PGF Name (RefSeq) placenta growth factor   KO K16859   placenta growth factor Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04010   MAPK signaling pathway ehs04510   Focal adhesion ehs04518   Integrin signaling Brite KEGG Orthology (KO) [BR:ehs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104510301 (PGF)   09133 Signaling molecules and interaction    04518 Integrin signaling     104510301 (PGF)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     104510301 (PGF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ehs04052]     104510301 (PGF) Cytokines and neuropeptides [BR:ehs04052]  Cytokines   Growth factors (RTK binding)    104510301 (PGF) SSDB OrthologParalogGFIT Motif Pfam:  PDGF Motif Other DBs NCBI-GeneID:  104510301 NCBI-ProteinID:  XP_010150798 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search LSFREIWNRSFCRPLEQLVDVISEFPNEVEYIFRPSCVSLQRCGGCCGGEGLRCIPVETR TVTMQLLKIKPNGEAPYVEMAFTEHKHCECR NT seq 278 nt NT seq  +upstreamnt  +downstreamnt tcctgtcctttcgggagatctggaatcgtagtttctgccggcctctggagcagctggtgg acgtcatttcggagttccccaacgaggtggagtacattttcagaccctcctgcgtctcgc tccagcgctgtggaggctgctgtgggggtgaggggctccgttgcattccggtcgagacga ggaccgtcaccatgcagctcctgaagataaagccgaacggggaggcaccctacgtggaga tggcattcaccgagcacaagcattgcgagtgcaggtag

DBGET integrated database retrieval system