Eurypyga helias (sunbittern): 104510382 Help Entry 104510382         CDS       T08356                                  Symbol FGF8 Name (RefSeq) fibroblast growth factor 8   KO K04358   fibroblast growth factor Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04010   MAPK signaling pathway ehs04020   Calcium signaling pathway ehs04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ehs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104510382 (FGF8)    04020 Calcium signaling pathway     104510382 (FGF8)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104510382 (FGF8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ehs04052]     104510382 (FGF8)    00536 Glycosaminoglycan binding proteins [BR:ehs00536]     104510382 (FGF8) Cytokines and neuropeptides [BR:ehs04052]  Cytokines   Growth factors (RTK binding)    104510382 (FGF8) Glycosaminoglycan binding proteins [BR:ehs00536]  Heparan sulfate / Heparin   Growth factors/receptors    104510382 (FGF8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF FRG1 Motif Other DBs NCBI-GeneID:  104510382 NCBI-ProteinID:  XP_010150917 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search KLIVETDTFGSRVRIKGAATGFYICMNKKGKLIGKSNGKGKDCVFTEIVLENNYTALQNA KYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPKGHQTTEPHRRFEFLNYPFNRRSKR TRNSSAKAGP NT seq 395 nt NT seq  +upstreamnt  +downstreamnt ccaagctcatcgtggagacggacacctttgggagccgtgtgcgcatcaagggggcagcca caggtttctacatctgcatgaacaagaaggggaagctgattggcaagagcaatggcaaag gcaaggactgcgtcttcacggagatcgtcctggagaacaactacacggcgctgcagaacg ccaagtacgagggctggtacatggccttcacccgcaagggccgcccgcgcaagggctcca agacccggcagcatcagcgggaggtgcatttcatgaagaggcttcctaagggccaccaga ccaccgagccccacagacgctttgagttcctcaactaccccttcaaccggaggagtaaaa ggactagaaactccagcgccaaggcaggcccgtga

DBGET integrated database retrieval system