Eurypyga helias (sunbittern): 104510775 Help Entry 104510775         CDS       T08356                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ehs  Eurypyga helias (sunbittern) Pathway ehs04010   MAPK signaling pathway ehs04020   Calcium signaling pathway ehs04114   Oocyte meiosis ehs04218   Cellular senescence ehs04310   Wnt signaling pathway ehs04370   VEGF signaling pathway ehs04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:ehs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104510775 (PPP3R1)    04310 Wnt signaling pathway     104510775 (PPP3R1)    04370 VEGF signaling pathway     104510775 (PPP3R1)    04020 Calcium signaling pathway     104510775 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104510775 (PPP3R1)    04218 Cellular senescence     104510775 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104510775 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ehs01009]     104510775 (PPP3R1) Protein phosphatases and associated proteins [BR:ehs01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104510775 (PPP3R1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  104510775 NCBI-ProteinID:  XP_010151436 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcgcactttgatgctgacgagataaaacgactaggaaagagatttaagaagctc gatttggacaactctggttctttgagcgtggaagagttcatgtccttacctgaattgcaa cagaacccgttagtacagcgagtaatagatatatttgacacggatggaaatggagaagtg gacttcaaagaatttatagaaggtgtctcccagttcagtgtcaaaggagataaggaacag aagttgaggtttgcttttcgcatttacgatatggacaaagatggttacatctcgaatgga gagctcttccaggtgctgaagatgatggttgggaacaatctcaaagacactcagttacag caaattgtagataaaaccataattaatgcagataaggatggcgatggaagaatatccttt gaagaattctgtgctgtcgtaggaggcctagatatccacaaaaagatggtcgtagacgtg tga

DBGET integrated database retrieval system