Eurypyga helias (sunbittern): 104511945 Help Entry 104511945         CDS       T08356                                  Symbol PFDN1 Name (RefSeq) prefoldin subunit 1   KO K09548   prefoldin subunit 1 Organism ehs  Eurypyga helias (sunbittern) Brite KEGG Orthology (KO) [BR:ehs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ehs03110]     104511945 (PFDN1) Chaperones and folding catalysts [BR:ehs03110]  Heat shock proteins   GimC    104511945 (PFDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prefoldin_2 Motif Other DBs NCBI-GeneID:  104511945 NCBI-ProteinID:  XP_010153048 UniProt:  A0A093J8G4 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLSKTKKHAHLTDTEVMMLVDETRM YEGVGRMFILQSKGVIHNQLLEKQRIAEEKIKELE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcggcgcccgtggacctagagctgaagaaggccttcaccgagctgcaggccaaggtg atagacacgcagcagaaggtgaagttggccgacatccagatcgagcagctgagcaagacg aagaagcacgcccacctcaccgacacggaggtcatgatgttggtggatgagacccgcatg tacgagggtgtggggaggatgtttattcttcagtctaaaggagtgattcataatcagctc ttagaaaaacagagaatagccgaagagaaaattaaggaattagag

DBGET integrated database retrieval system