Eurypyga helias (sunbittern): 104515981 Help Entry 104515981         CDS       T08356                                  Symbol RFC5 Name (RefSeq) replication factor C subunit 5   KO K10756   replication factor C subunit 3/5 Organism ehs  Eurypyga helias (sunbittern) Pathway ehs03030   DNA replication ehs03410   Base excision repair ehs03420   Nucleotide excision repair ehs03430   Mismatch repair Brite KEGG Orthology (KO) [BR:ehs00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     104515981 (RFC5)    03410 Base excision repair     104515981 (RFC5)    03420 Nucleotide excision repair     104515981 (RFC5)    03430 Mismatch repair     104515981 (RFC5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ehs03032]     104515981 (RFC5)    03036 Chromosome and associated proteins [BR:ehs03036]     104515981 (RFC5)    03400 DNA repair and recombination proteins [BR:ehs03400]     104515981 (RFC5) DNA replication proteins [BR:ehs03032]  Eukaryotic type   DNA Replication Elongation Factors    RFC (replication factor C)     104515981 (RFC5)   DNA Replication Termination Factors    ELG1-RFC complex     104515981 (RFC5) Chromosome and associated proteins [BR:ehs03036]  Eukaryotic type   Sister chromatid cohesion proteins    CTF18-RFC complex     104515981 (RFC5) DNA repair and recombination proteins [BR:ehs03400]  Eukaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     RFC (replication factor C)      104515981 (RFC5)   Check point factors    HRAD17(Rad24)-RFC complex     104515981 (RFC5) SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac_C DNA_pol3_delta2 AAA AAA_assoc_2 RCF1-5-like_lid AAA_lid_RFC1 DEAD Motif Other DBs NCBI-GeneID:  104515981 NCBI-ProteinID:  XP_010158465 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search KGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGP LTPELMVPRLVDVTEDGMKALVTLSSGDMRRALNILQSTTMAFGKVTEENVYTCTGHPLK SDIANILDWMLNQDFSTAYRSILELKTLKGLALQDILTEIHLFVHR NT seq 500 nt NT seq  +upstreamnt  +downstreamnt gaaaggcttcaagctcgtcatcctggacgaagccgacgccatgacccaggacgcccagaa cgccctgaggcgagtgatcgagaagttcacggaaaacacccgcttttgcctcatctgcaa ctacctctccaagatcattcccgccttgcaatcccgctgcacacgcttccgcttcggccc cctcacccccgagctgatggtgccccggctggtggatgtgaccgaggatgggatgaaggc tctggtgacgctctcgagcggtgacatgcgcagagccctcaatatcttgcagagcaccac catggccttcgggaaggtgacggaggagaacgtctacacctgcacgggacaccccctcaa gtcggacattgccaacatcctcgactggatgctgaaccaggacttttccaccgcctaccg cagtattttggagctgaagacgctgaagggcttggccctgcaggacatcctcaccgagat ccacctctttgtgcacagag

DBGET integrated database retrieval system