Enterobacter huaxiensis: D5067_0014155 Help Entry D5067_0014155     CDS       T08129                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ehu  Enterobacter huaxiensis Pathway ehu01100   Metabolic pathways ehu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ehu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D5067_0014155 (acpP)    00074 Mycolic acid biosynthesis     D5067_0014155 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D5067_0014155 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  UNC50668 LinkDB All DBs Position complement(2940203..2940439) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system