Emiliania huxleyi: EMIHUDRAFT_197919 Help Entry EMIHUDRAFT_197919 CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K03134   transcription initiation factor TFIID subunit 10 Organism ehx  Emiliania huxleyi Pathway ehx03022   Basal transcription factors Brite KEGG Orthology (KO) [BR:ehx00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     EMIHUDRAFT_197919  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ehx03021]     EMIHUDRAFT_197919    03036 Chromosome and associated proteins [BR:ehx03036]     EMIHUDRAFT_197919 Transcription machinery [BR:ehx03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIID      EMIHUDRAFT_197919    Coactivators     SAGA/TFTC/STAGA complex      EMIHUDRAFT_197919 Chromosome and associated proteins [BR:ehx03036]  Eukaryotic type   Histone modification proteins    HAT complexes     PCAF complex      EMIHUDRAFT_197919     STAGA complex      EMIHUDRAFT_197919     TFTC complex      EMIHUDRAFT_197919     SAGA complex      EMIHUDRAFT_197919     SLIK complex      EMIHUDRAFT_197919 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TAF10 Motif Other DBs NCBI-GeneID:  17255586 NCBI-ProteinID:  XP_005761900 JGI:  Emihu1_197919 UniProt:  A0A0D3IDY6 R1DF89 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MNNNGTSEVCREQKFFFALRWDKMASSVAASSVAASSASAMTDDEKTAEELLLAMGDYTP AIPEEVTAHFLAQSGFQATDERLCGLAPPAGGPW NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaataacaatggcacgtctgaagtctgccgcgagcaaaaattcttcttcgccctccgg tgggacaaaatggcgtcgagcgtcgcggcgtcgagcgtggcggcgtcgagcgcctccgcg atgacggacgacgagaagacggcggaggagctgctgctcgcgatgggcgactacacgccc gcgattcctgaggaggtgaccgcgcacttcttggcgcagtcgggcttccaggcgacggac gagcgcttgtgcggcttggcccctccagcgggtggaccgtggtga

DBGET integrated database retrieval system