Emiliania huxleyi: EMIHUDRAFT_232772 Help Entry EMIHUDRAFT_232772 CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K19683   tetratricopeptide repeat protein 30 Organism ehx  Emiliania huxleyi Brite KEGG Orthology (KO) [BR:ehx00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ehx03037]     EMIHUDRAFT_232772 Cilium and associated proteins [BR:ehx03037]  Primary cilia and associated proteins   Intraflagellar transport (IFT) complex B1    EMIHUDRAFT_232772 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DUF1931 Motif Other DBs NCBI-GeneID:  17275862 NCBI-ProteinID:  XP_005783017 JGI:  Emihu1_232772 UniProt:  A0A0D3K4A3 R1D5E2 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MTPDKFQRNERVATATSDLQGNFEFGIGRVMKSLEPYPKKLGTDTWFYAKRVFLALAETL AKHMIMLKADVCTRPAGREA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcccgacaagtttcagcgtaacgagcgggtagcaactgccacctcggatttgcag ggcaacttcgagtttggcatcgggcgcgtaatgaagtcgctcgagccgtacccgaagaag ctcggaaccgacacctggttctacgcgaagcgtgtattccttgcactcgccgagacgctc gcaaagcacatgatcatgctcaaggccgacgtctgcacacggccggccgggcgagaggct tga

DBGET integrated database retrieval system