Emiliania huxleyi: EMIHUDRAFT_237844 Help Entry EMIHUDRAFT_237844 CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism ehx  Emiliania huxleyi Pathway ehx03060   Protein export ehx04141   Protein processing in endoplasmic reticulum ehx04145   Phagosome Brite KEGG Orthology (KO) [BR:ehx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     EMIHUDRAFT_237844    04141 Protein processing in endoplasmic reticulum     EMIHUDRAFT_237844  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EMIHUDRAFT_237844  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehx04131]     EMIHUDRAFT_237844   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ehx02044]     EMIHUDRAFT_237844 Membrane trafficking [BR:ehx04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     EMIHUDRAFT_237844 Secretion system [BR:ehx02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    EMIHUDRAFT_237844 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  17270858 NCBI-ProteinID:  XP_005777742 JGI:  Emihu1_237844 UniProt:  A0A0D3JP78 R1CQM7 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MPDDWRLSRASPTPPPLRNPSQAGEGQAGGTLTKRPGTSGGGGAAKGPASGSVMARKAAA RRPTARSGGGGNGAGILRFYTDDAPGLKIGPTTVLVLSLLFIAFVVLLHIWGKFRKG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgcccgacgattggcgcctctcgcgtgcaagtcccactccgcctcccctccgcaacccc tcccaggcgggcgaagggcaggctggcggcacgctgaccaagcggcccggcacctcgggt ggtggcggggccgccaagggccccgcaagcggctctgtcatggcgcgcaaggcggcggcc aggcggccgacggctcgctcgggcggcggcggcaatggggcgggcatcctgcgcttctac actgatgacgcgccgggcctgaaaatcgggccgaccaccgtgctcgtgctgagcctgctg ttcatcgcgttcgtcgtgctgctgcacatctggggtaagttccgcaagggctag

DBGET integrated database retrieval system