Emiliania huxleyi: EMIHUDRAFT_254815 Help Entry EMIHUDRAFT_254815 CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism ehx  Emiliania huxleyi Pathway ehx03060   Protein export ehx04141   Protein processing in endoplasmic reticulum ehx04145   Phagosome Brite KEGG Orthology (KO) [BR:ehx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     EMIHUDRAFT_254815    04141 Protein processing in endoplasmic reticulum     EMIHUDRAFT_254815  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EMIHUDRAFT_254815  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehx04131]     EMIHUDRAFT_254815   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ehx02044]     EMIHUDRAFT_254815 Membrane trafficking [BR:ehx04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     EMIHUDRAFT_254815 Secretion system [BR:ehx02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    EMIHUDRAFT_254815 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  17269773 NCBI-ProteinID:  XP_005776655 JGI:  Emihu1_254815 UniProt:  A0A0D3JL41 R1EMM6 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPDDWHTPPSAPPSASLKRPVSLQPASPRAAGEGQAGGTLTKRPGTSGGGGAAKGPASGS VMARKAAARRPTARSGGGGNGAGILRFYTDDAPGLKM NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcccgacgattggcacactccgcccagcgcgccgccgtccgcttccttgaagcgccct gtcagtctgcagccggcgagcccccgtgcggcgggcgaagggcaggctggcggcacgctg accaagcggcccggcacctcgggtggtggcggggccgccaagggccccgcaagcggctct gtcatggcgcgcaaggcggcggccaggcggccgacggctcgctcgggcggcggcggcaat ggggcgggcatcctgcgcttctacactgatgacgcgccgggcctgaaaatgtga

DBGET integrated database retrieval system