Emiliania huxleyi: EMIHUDRAFT_254911 Help Entry EMIHUDRAFT_254911 CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism ehx  Emiliania huxleyi Pathway ehx03030   DNA replication ehx03082   ATP-dependent chromatin remodeling ehx03410   Base excision repair ehx03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ehx00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     EMIHUDRAFT_254911    03410 Base excision repair     EMIHUDRAFT_254911    03420 Nucleotide excision repair     EMIHUDRAFT_254911   09126 Chromosome    03082 ATP-dependent chromatin remodeling     EMIHUDRAFT_254911  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ehx03032]     EMIHUDRAFT_254911    03036 Chromosome and associated proteins [BR:ehx03036]     EMIHUDRAFT_254911    03400 DNA repair and recombination proteins [BR:ehx03400]     EMIHUDRAFT_254911 Enzymes [BR:ehx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      EMIHUDRAFT_254911 DNA replication proteins [BR:ehx03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     EMIHUDRAFT_254911 Chromosome and associated proteins [BR:ehx03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     EMIHUDRAFT_254911 DNA repair and recombination proteins [BR:ehx03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       EMIHUDRAFT_254911 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Motif Other DBs NCBI-GeneID:  17269167 NCBI-ProteinID:  XP_005776049 JGI:  Emihu1_254911 UniProt:  R1EA99 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MPAEAQQASPADGKAAAGSGGQQTTLGKRPAESGAVAPLPSNMALPNAVVQRLIKSKLPD GVMLHKDARAAFNKSTSIFILMLTTIASDISREAKRSTVTGQDVLNALKASERPPSPAGS AAWRERGPP NT seq 388 nt NT seq  +upstreamnt  +downstreamnt atgcctgccgaggctcagcaggcgtcgccggcggacggcaaggcggcggcgggcagcggg ggccagcagacgacgcttggcaagcgcccggccgagagcggcgccgtcgccccgctcccg tccaacatggcgctgccgaacgccgtcgtgcagcggctcatcaagtcaaagctgccggac ggcgtgatgctgcacaaggacgcgcgcgccgcgttcaacaagtcgacgtcaatcttcatc ctgatgctcaccaccatagcgagcgacatcagcagggaggcgaagcgctcgacggtgacg gggcaggacgtgctcaacgcactcaaggcgagcgagcggccgccctcccccgccggctcg gcagcttggcgagagcgcggcccgcctc

DBGET integrated database retrieval system