Emiliania huxleyi: EMIHUDRAFT_366391 Help Entry EMIHUDRAFT_366391 CDS       T02915                                  Symbol DYNL1 Name (RefSeq) dynein light chain   KO K10418   dynein light chain LC8-type Organism ehx  Emiliania huxleyi Pathway ehx04814   Motor proteins Brite KEGG Orthology (KO) [BR:ehx00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     EMIHUDRAFT_366391 (DYNL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ehx03037]     EMIHUDRAFT_366391 (DYNL1)    04812 Cytoskeleton proteins [BR:ehx04812]     EMIHUDRAFT_366391 (DYNL1) Cilium and associated proteins [BR:ehx03037]  Motile cilia and associated proteins   Dynein arm    EMIHUDRAFT_366391 (DYNL1) Cytoskeleton proteins [BR:ehx04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      EMIHUDRAFT_366391 (DYNL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop Motif Other DBs NCBI-GeneID:  17273584 NCBI-ProteinID:  XP_005780468 JGI:  Emihu1_366391 UniProt:  A0A0D3JPE5 R1EF95 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MGDRKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDLAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgggtgaccgcaaagccgtgatcaagaatgcagacatgtccgaggacatgcagcaggac gccgtcgactgcgcgacgcaggcgctggagaagtacaacatcgagaaggacctggccgcg tacatcaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgtcggccgc aactttggctcgtacgtcacacacgagacgaagcacttcatctacttctacttgggccag gttgctatcctcctcttcaagagcggctga

DBGET integrated database retrieval system