KEGG   Emiliania huxleyi: EMIHUDRAFT_434598
Entry
EMIHUDRAFT_434598 CDS       T02915                                 
Name
(RefSeq) hypothetical protein
  KO
K03094  S-phase kinase-associated protein 1
Organism
ehx  Emiliania huxleyi
Pathway
ehx03083  Polycomb repressive complex
ehx04120  Ubiquitin mediated proteolysis
ehx04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EMIHUDRAFT_434598
   04120 Ubiquitin mediated proteolysis
    EMIHUDRAFT_434598
  09126 Chromosome
   03083 Polycomb repressive complex
    EMIHUDRAFT_434598
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ehx04131]
    EMIHUDRAFT_434598
   04121 Ubiquitin system [BR:ehx04121]
    EMIHUDRAFT_434598
   03036 Chromosome and associated proteins [BR:ehx03036]
    EMIHUDRAFT_434598
Membrane trafficking [BR:ehx04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    EMIHUDRAFT_434598
Ubiquitin system [BR:ehx04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     EMIHUDRAFT_434598
   Cul7 complex
     EMIHUDRAFT_434598
Chromosome and associated proteins [BR:ehx03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     EMIHUDRAFT_434598
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     EMIHUDRAFT_434598
SSDB
Motif
Pfam: Skp1 Skp1_POZ BTB
Other DBs
NCBI-GeneID: 19046555
NCBI-ProteinID: XP_005781634
JGI: Emihu1_434598
UniProt: A0A0D3K0C0 R1ERE6
LinkDB
Position
Unknown
AA seq 157 aa
MADDSEATAVKLKSKQEEIFEVEKEVACRSVTVKNMVEDTGLDTPVPLPMVDSKILIKVI
EYCKYHHRAEQESLPEDEKNVWDKDFVKVDDETLFNLILAANYLDIKSLLDLTCKTVADE
IKGKTPEEIRIRFNIKNDFTPEEEEEVKRENAWCEER
NT seq 474 nt   +upstreamnt  +downstreamnt
atggctgacgactctgaggcgactgctgtcaagctcaagtccaagcaggaggagatcttt
gaggttgagaaggaggttgcctgccgctcggtgaccgtcaagaacatggtcgaggacacg
ggcctcgacacgccggtgccgctgccgatggtcgactcgaagattctcatcaaggtgatt
gagtactgcaagtaccaccaccgcgcggagcaggagtcgctgcccgaggacgagaagaac
gtctgggacaaggactttgtcaaggtcgacgacgagacgctcttcaacctgatccttgca
gccaactatctcgacatcaagtcgctgctcgacctcacctgcaagacggtggccgatgaa
atcaagggcaagacgcccgaggagatccgcatccgcttcaacatcaagaacgacttcaca
cccgaagaggaggaggaggtcaagcgtgaaaacgcttggtgcgaggagcgctga

DBGET integrated database retrieval system