Emiliania huxleyi: EMIHUDRAFT_48267 Help Entry EMIHUDRAFT_48267  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K11253   histone H3 Organism ehx  Emiliania huxleyi Brite KEGG Orthology (KO) [BR:ehx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ehx03036]     EMIHUDRAFT_48267   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ehx04147]     EMIHUDRAFT_48267 Chromosome and associated proteins [BR:ehx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     EMIHUDRAFT_48267 Exosome [BR:ehx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EMIHUDRAFT_48267 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  17253081 NCBI-ProteinID:  XP_005759348 JGI:  Emihu1_48267 UniProt:  A0A0D3I6N4 R1DDS4 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search RYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVVELQEASEAYLVGLFEDTNLCAI HAKRVTIMPKDIQLARRIRGERA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt cgctaccagaagtcgacggagctcctgatccgcaagctgcccttccagcgcctggtgcgc gagatcgcgcaggacttcaagaccgacctgcgcttccagtcgtcggccgtcgtcgagctc caggaggcgtccgaggcctacctcgtcggcctcttcgaggacaccaacctgtgcgccatc cacgccaagcgcgtcaccatcatgcccaaggacatccagctggcccgccgcatccgcgga gagcgcgcg

DBGET integrated database retrieval system