Emiliania huxleyi: EMIHUDRAFT_48894 Help Entry EMIHUDRAFT_48894  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K26537   protein UXT Organism ehx  Emiliania huxleyi Brite KEGG Orthology (KO) [BR:ehx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ehx03036]     EMIHUDRAFT_48894    03029 Mitochondrial biogenesis [BR:ehx03029]     EMIHUDRAFT_48894 Chromosome and associated proteins [BR:ehx03036]  Eukaryotic type   Histone modification proteins    Other histone modification proteins     EMIHUDRAFT_48894 Mitochondrial biogenesis [BR:ehx03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     EMIHUDRAFT_48894 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prefoldin ITGAX-like_Ig_3 Takusan Motif Other DBs NCBI-GeneID:  17278890 NCBI-ProteinID:  XP_005786047 JGI:  Emihu1_48894 UniProt:  R1DDR9 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search EHLVNEQLKSDLQQVLERRDALYERIAHCLELRNNMTMLLDEQLHSLKTKVNLGCDFYVD ASIPDTSWVYVSVGLGFHAQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gagcacctggtcaatgagcagctcaagtcagacctgcagcaggtgctcgagcggcgcgac gcgctgtacgagcgcatcgcgcactgcctggagttgcgcaacaacatgacgatgctgctg gacgagcagctgcactcgctcaagacaaaggtcaacctcggctgtgacttttacgtcgat gcgagcatacccgacacgtcgtgggtgtacgtgagtgtcgggctcggcttccacgcgcag

DBGET integrated database retrieval system