Emiliania huxleyi: EMIHUDRAFT_49408 Help Entry EMIHUDRAFT_49408  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K16535   lisH domain-containing protein FOPNL Organism ehx  Emiliania huxleyi Brite KEGG Orthology (KO) [BR:ehx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ehx03036]     EMIHUDRAFT_49408   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ehx03037]     EMIHUDRAFT_49408 Chromosome and associated proteins [BR:ehx03036]  Eukaryotic type   Centrosome formation proteins    Pericentriolar materials (PCM)     Centriolar satellite      EMIHUDRAFT_49408 Cilium and associated proteins [BR:ehx03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    EMIHUDRAFT_49408 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FOP_dimer LisH_2 ARMC9_LisH LisH DUF2095 Motif Other DBs NCBI-GeneID:  17281077 NCBI-ProteinID:  XP_005788233 JGI:  Emihu1_49408 UniProt:  R1BV25 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search QQALRAALRETLDAKGVLRELRARIQAEVFSAVRDTSDPRPRLSQEKLLLNEAIREYLEF SGYNHTLSVFLAEAGQPEEKLARQVVAGQLRL NT seq 276 nt NT seq  +upstreamnt  +downstreamnt cagcaggcgctccgcgccgcgctgcgggagacgctcgacgccaagggcgttctgcgggag ctgcgggcgcggatccaggcggaggtgttctcggcggtgcgtgacacgagcgacccgcgt ccacggctcagccaggagaagctactgctcaacgaggcgatccgagagtacctcgagttt tcagggtacaaccacacgctgtcggtcttcctcgccgaggcgggccagccggaggagaag ctggcgcgccaggtggtcgccggccagctccgcctg

DBGET integrated database retrieval system