Emiliania huxleyi: EMIHUDRAFT_50103 Help Entry EMIHUDRAFT_50103  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ehx  Emiliania huxleyi Pathway ehx03010   Ribosome ehx04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ehx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     EMIHUDRAFT_50103   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EMIHUDRAFT_50103  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ehx03011]     EMIHUDRAFT_50103    04121 Ubiquitin system [BR:ehx04121]     EMIHUDRAFT_50103 Ribosome [BR:ehx03011]  Ribosomal proteins   Eukaryotes    Large subunit     EMIHUDRAFT_50103   Archaea     EMIHUDRAFT_50103 Ubiquitin system [BR:ehx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    EMIHUDRAFT_50103 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Ubiquitin_5 TBK1_ULD HATPase_c DUF2604 FlgD_ig UBL_IKK Motif Other DBs NCBI-GeneID:  17276882 NCBI-ProteinID:  XP_005784036 JGI:  Emihu1_50103 UniProt:  A0A0D3K772 LinkDB All DBs Position Unknown AA seq 66 aa AA seqDB search QIFVKTLTGKTITLEVEPSDSIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI QKESTL NT seq 199 nt NT seq  +upstreamnt  +downstreamnt cagattttcgtcaagacgctcacgggcaagaccatcaccctcgaggtggagccctctgac tcgatcgacaacgtcaaggccaagatccaggacaaggagggcatcccgcccgaccagcag cgcctcatcttcgcgggcaagcagctcgaggacggccgcaccctctccgactacaacatc cagaaggagtcgacgctgc

DBGET integrated database retrieval system