Emiliania huxleyi: EMIHUDRAFT_59123 Help Entry EMIHUDRAFT_59123  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K04798   prefoldin beta subunit Organism ehx  Emiliania huxleyi Brite KEGG Orthology (KO) [BR:ehx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ehx03110]     EMIHUDRAFT_59123 Chaperones and folding catalysts [BR:ehx03110]  Heat shock proteins   GimC    EMIHUDRAFT_59123 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prefoldin_2 Motif Other DBs NCBI-GeneID:  17275492 NCBI-ProteinID:  XP_005782648 JGI:  Emihu1_59123 UniProt:  A0A0D3K384 R1C287 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search VLKELELLEEDAQVFKLIGPVLVKQELVEVKSNVNKRIEYIKADATRIERSLKAKNDEQN TVKEQIQALQK NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgctcaaggagctcgagctgttggaggaggacgcgcaggtgttcaagctcatcgggccg gtgctagtcaagcaggagcttgtcgaggtcaagtcgaacgtgaacaagcggatcgagtac atcaaggcggacgcgacgaggatcgagcggagcctgaaggccaagaacgacgagcagaac accgtcaaggagcagatccaggcgttgcaaaag

DBGET integrated database retrieval system