Emiliania huxleyi: EMIHUDRAFT_59293 Help Entry EMIHUDRAFT_59293  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K03104   signal recognition particle subunit SRP14 Organism ehx  Emiliania huxleyi Pathway ehx03060   Protein export Brite KEGG Orthology (KO) [BR:ehx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     EMIHUDRAFT_59293  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ehx02044]     EMIHUDRAFT_59293 Secretion system [BR:ehx02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    EMIHUDRAFT_59293 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SRP14 Motif Other DBs NCBI-GeneID:  17265679 NCBI-ProteinID:  XP_005772563 JGI:  Emihu1_59293 UniProt:  A0A0D3J9E9 R1EH02 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MVLHDADGFLTQLTRMLERSREKGAVYVTMKRCAFAPAAPAAGVARLSPVDPADCRCLVR AVLGSTKATASTMVAAKDHRRFMKSYANIMKAGATA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggtgctgcacgacgccgacggcttcctgacgcagctcacgcgcatgctggagcggtcg cgcgagaagggcgccgtctacgtcacgatgaagcgatgtgcgtttgcgcctgccgcgccc gccgccggtgtagcacgcctgagcccggtcgaccccgccgactgccgctgcctcgttcgc gccgtgctcggcagcaccaaggcaacagcgtcgacgatggtcgccgccaaggaccaccgc cgcttcatgaagtcgtacgcaaacatcatgaaggcgggcgccaccgcc

DBGET integrated database retrieval system