Emiliania huxleyi: EMIHUDRAFT_59313 Help Entry EMIHUDRAFT_59313  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K11270   chromosome transmission fidelity protein 8 Organism ehx  Emiliania huxleyi Brite KEGG Orthology (KO) [BR:ehx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ehx03036]     EMIHUDRAFT_59313 Chromosome and associated proteins [BR:ehx03036]  Eukaryotic type   Sister chromatid cohesion proteins    CTF18-RFC complex     EMIHUDRAFT_59313 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ctf8 Motif Other DBs NCBI-GeneID:  17275773 NCBI-ProteinID:  XP_005782928 JGI:  Emihu1_59313 UniProt:  R1FB84 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search SQGAVWLRIGKGEMPGERVRLKKPLAIMSKVRPDGDVPSPGGSPPACEYHAVGVVREKLV FNTRPTPI NT seq 204 nt NT seq  +upstreamnt  +downstreamnt tcgcagggcgctgtgtggctccggatcggcaagggcgaaatgccgggagagagggttcgg ctaaagaagccgctcgccatcatgtccaaggtgcggcccgatggggacgtgccgagcccg gggggctcgccgccggcgtgcgagtaccatgcggtcggcgtcgtccgagagaagctcgtc ttcaacacgcggccgaccccgatc

DBGET integrated database retrieval system