Emiliania huxleyi: EMIHUDRAFT_60777 Help Entry EMIHUDRAFT_60777  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism ehx  Emiliania huxleyi Pathway ehx04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:ehx00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     EMIHUDRAFT_60777  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ehx01009]     EMIHUDRAFT_60777   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ehx04131]     EMIHUDRAFT_60777    03036 Chromosome and associated proteins [BR:ehx03036]     EMIHUDRAFT_60777   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ehx04147]     EMIHUDRAFT_60777 Protein phosphatases and associated proteins [BR:ehx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      EMIHUDRAFT_60777 Membrane trafficking [BR:ehx04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     EMIHUDRAFT_60777 Chromosome and associated proteins [BR:ehx03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      EMIHUDRAFT_60777 Exosome [BR:ehx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    EMIHUDRAFT_60777 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 Dockerin_1 EH Motif Other DBs NCBI-GeneID:  17251301 NCBI-ProteinID:  XP_005757615 JGI:  Emihu1_60777 UniProt:  A0A0D3I1Q1 R1D2Y8 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search DRDGNGHIEARELSSVMRRLGLKASTEGTTQMMDAADVDGNGQIEFPEFVLIMGKRVLEE DGRVELECAFRLLAQQGSGLVKVEDVKALLTTAGQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gaccgagacggcaacggccacatcgaggccagggagctgtcgagcgtcatgcgacgcctc gggctcaaggctagcacggaaggaacaactcagatgatggatgcggcagatgtggacggg aacgggcagattgagtttccagagtttgtgctcatcatgggcaagcgggttctcgaggag gacggcagggtggagctcgagtgtgctttccgactccttgcacaacaagggtctgggctg gtgaaagtagaggatgtgaaagcgctgctgacgacggcgggccag

DBGET integrated database retrieval system