Emiliania huxleyi: EMIHUDRAFT_64146 Help Entry EMIHUDRAFT_64146  CDS       T02915                                  Name (RefSeq) hypothetical protein   KO K10420   dynein light chain Tctex-type 1/3 Organism ehx  Emiliania huxleyi Pathway ehx04145   Phagocytosis ehx04814   Motor proteins Brite KEGG Orthology (KO) [BR:ehx00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     EMIHUDRAFT_64146   09142 Cell motility    04814 Motor proteins     EMIHUDRAFT_64146  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ehx03037]     EMIHUDRAFT_64146    04812 Cytoskeleton proteins [BR:ehx04812]     EMIHUDRAFT_64146 Cilium and associated proteins [BR:ehx03037]  Motile cilia and associated proteins   Dynein arm    EMIHUDRAFT_64146 Cytoskeleton proteins [BR:ehx04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      EMIHUDRAFT_64146 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Yop-YscD_ppl_1st Motif Other DBs NCBI-GeneID:  17274009 NCBI-ProteinID:  XP_005780892 JGI:  Emihu1_64146 UniProt:  A0A0D3JY78 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MSSRRQSVESVLSNASYNHVKVPQWTNDVIELTMKRLKELNQPFKYIVTCAIMQKNGAGL HMATSTFWDNSSDGSATLKWDSKTMYCMTTVFGLSI NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcgtctcgccgccagtctgtggagtcagtgctgtccaacgcctcgtacaaccacgtg aaggtacctcaatggaccaacgatgtgattgagctgaccatgaagcggctcaaggagctg aaccagccattcaagtacattgtgacgtgtgcgataatgcagaagaatggcgctgggctg cacatggcgacgtcaacgttctgggataactcttccgacgggagcgcaacgctcaagtgg gacagtaagacaatgtactgcatgaccaccgtctttggcctctcgatctga

DBGET integrated database retrieval system