Edwardsiella ictaluri: NT01EI_2368 Help Entry NT01EI_2368       CDS       T00912                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism eic  Edwardsiella ictaluri Pathway eic00998   Biosynthesis of various antibiotics eic01100   Metabolic pathways eic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NT01EI_2368    00074 Mycolic acid biosynthesis     NT01EI_2368   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NT01EI_2368 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  ACR69539 UniProt:  C5B8G9 LinkDB All DBs Position complement(2270286..2270522) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKEDEVVNSASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYIEAANK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgaacagctgggtgttaaagaa gacgaagttgtgaattcagcttctttcgttgacgatctgggtgctgattctcttgatacc gttgaactggttatggctctggaagaagagtttgatactgagattccggatgaagaagca gagaagatcaccactgttcaggccgctatcgactacatcgaagctgcaaacaagtaa

DBGET integrated database retrieval system