Entamoeba invadens: EIN_084760 Help Entry EIN_084760        CDS       T04133                                  Name (RefSeq) RAC GTPase, putative   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism eiv  Entamoeba invadens Pathway eiv04145   Phagosome eiv04148   Efferocytosis eiv04620   Toll-like receptor signaling pathway eiv05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:eiv00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EIN_084760    04148 Efferocytosis     EIN_084760  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     EIN_084760  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     EIN_084760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eiv04131]     EIN_084760   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eiv04147]     EIN_084760    04031 GTP-binding proteins [BR:eiv04031]     EIN_084760 Membrane trafficking [BR:eiv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     EIN_084760  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     EIN_084760   Macropinocytosis    Ras GTPases     EIN_084760  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     EIN_084760 Exosome [BR:eiv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EIN_084760   Exosomal proteins of other body fluids (saliva and urine)    EIN_084760   Exosomal proteins of colorectal cancer cells    EIN_084760   Exosomal proteins of bladder cancer cells    EIN_084760 GTP-binding proteins [BR:eiv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     EIN_084760 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU DUF5105 Motif Other DBs NCBI-GeneID:  14884129 NCBI-ProteinID:  XP_004184620 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search MAQPNNPDATTVKLVVVGDGAVGKTCLLICYTTNEFPKDYVPTVFDNYIAPMTVDGKAIN LGLWDTAGQEDYEQLRPLSYPNTDLFLLCFSVISRTSFNNITAKWLPEIRHYEPKCRVML VGTKTDCRNDEAVLRKLAEDNQKPLTTEDGERLAKEIKASCYMECSALTRSGLNQVFDEA LHTVLNQTQQAKKTKFCTLL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggctcagccaaacaatccagacgcgaccactgtaaaattggtagtagtaggcgacggt gctgtcggaaaaacatgccttttgatttgctataccacaaacgaatttccaaaggactac gttccaacagtgtttgacaattacatagcaccaatgacggttgatggcaaggcgataaac ttggggttgtgggatacggccgggcaagaagactacgagcagctcaggccattgtcctac ccaaacacagaccttttccttctctgtttttcggtaatatcgagaacgtcctttaacaat atcacagcaaagtggcttcccgagattcgtcattatgaaccaaaatgccgcgtcatgctt gtcggaacgaaaaccgattgccgaaacgatgaagctgttcttcgtaaattggccgaagac aatcaaaaaccattaacaacagaagatggcgaaaggcttgccaaagagatcaaagcatcg tgttatatggaatgttctgctttgacacgttcgggtcttaaccaagtatttgatgaagct ttacacacagtcttgaaccaaacgcaacaggccaaaaaaacgaaattttgcaccttgttg taa

DBGET integrated database retrieval system