Entamoeba invadens: EIN_096340 Help Entry EIN_096340        CDS       T04133                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism eiv  Entamoeba invadens Pathway eiv04145   Phagosome eiv04148   Efferocytosis eiv04620   Toll-like receptor signaling pathway eiv05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:eiv00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EIN_096340    04148 Efferocytosis     EIN_096340  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     EIN_096340  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     EIN_096340  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eiv04131]     EIN_096340   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eiv04147]     EIN_096340    04031 GTP-binding proteins [BR:eiv04031]     EIN_096340 Membrane trafficking [BR:eiv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     EIN_096340  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     EIN_096340   Macropinocytosis    Ras GTPases     EIN_096340  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     EIN_096340 Exosome [BR:eiv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EIN_096340   Exosomal proteins of other body fluids (saliva and urine)    EIN_096340   Exosomal proteins of colorectal cancer cells    EIN_096340   Exosomal proteins of bladder cancer cells    EIN_096340 GTP-binding proteins [BR:eiv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     EIN_096340 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc AAA_24 VapE-like_dom ATPase RE_NgoBV AAA_16 Arf NACHT adh_short_C2 Motif Other DBs NCBI-GeneID:  14886444 NCBI-ProteinID:  XP_004254148 UniProt:  A0A0A1U0I3 LinkDB All DBs Position Unknown AA seq 185 aa AA seqDB search MKVCIVGSQGIGKTSFVSKFTRNSISDSVVITETSDYEVSITVKGRIVDLDIHDMQMCES PIERKRVFNQTDCFLLCFAMNDRKSFEDIKTKWFNEVTEVSDGRCVLVGLKADLKDVKQS VVTDTEICNLAQQLKTCGWATLSIYRHKGIKDLFDFIAYGVSIPCFSPTRKESERKKIAK NRIAL NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgaaggtgtgtattgttggcagtcaaggtatagggaagacgtcgtttgtctccaaattt acgcggaattcgatcagtgattctgttgttattacggagacgtcggactatgaagtttcc atcacggtgaaggggcgaattgtcgatttagacatccacgacatgcagatgtgtgaaagt ccgattgagcgcaaaagggtgttcaaccaaactgattgctttctcctctgttttgcgatg aacgatagaaagtcgtttgaagacatcaagacaaagtggtttaatgaagtcacagaagtc tctgatgggcggtgtgtcttagttggtctcaaagcagacttgaaagatgtgaagcaaagt gtcgtcacagacactgaaatttgtaatttggcacaacaactcaagacatgtgggtgggcg acgctttcaatatatcgacataaaggaattaaagatctttttgactttatcgcatatggg gtgtccatcccttgcttctcgcctactcgaaaggaaagtgaaagaaaaaagatcgcaaaa aatcgaatagctctttaa

DBGET integrated database retrieval system