Entamoeba invadens: EIN_314730 Help Entry EIN_314730        CDS       T04133                                  Name (RefSeq) histone H3, putative   KO K11253   histone H3 Organism eiv  Entamoeba invadens Brite KEGG Orthology (KO) [BR:eiv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eiv03036]     EIN_314730   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eiv04147]     EIN_314730 Chromosome and associated proteins [BR:eiv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     EIN_314730 Exosome [BR:eiv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EIN_314730 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S TFIID-31kDa CBFD_NFYB_HMF Nro1_C Motif Other DBs NCBI-GeneID:  14886007 NCBI-ProteinID:  XP_004253685 UniProt:  A0A0A1TZC5 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MLAKDSLKKRRAHPGAVALTEIKILQRTTDMLLKKAPFQHVVREIAQSYSTDLRFQSSAL MALQEAAEAYLVGLFEDSNLCAIHAKRVTIMPKDIQLARRIRGERT NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgttggcaaaggactcactaaagaagagacgcgcacatccaggtgccgttgctctgact gaaatcaaaattttgcagagaacaacagatatgttgcttaaaaaagcaccatttcaacac gttgtgagggagattgcgcaatcatattcgacagaccttagattccaaagctcggctttg atggcactccaggaagctgctgaggcatacttagtcggtctttttgaggattccaatttg tgcgcaattcatgcgaagagagttaccattatgccaaaagatattcagctcgccagaaga attcggggcgagagaacataa

DBGET integrated database retrieval system