Entamoeba invadens: EIN_412190 Help Entry EIN_412190        CDS       T04133                                  Name (RefSeq) Rho GTPase, putative   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism eiv  Entamoeba invadens Pathway eiv04145   Phagosome eiv04148   Efferocytosis eiv04620   Toll-like receptor signaling pathway eiv05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:eiv00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EIN_412190    04148 Efferocytosis     EIN_412190  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     EIN_412190  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     EIN_412190  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eiv04131]     EIN_412190   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eiv04147]     EIN_412190    04031 GTP-binding proteins [BR:eiv04031]     EIN_412190 Membrane trafficking [BR:eiv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     EIN_412190  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     EIN_412190   Macropinocytosis    Ras GTPases     EIN_412190  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     EIN_412190 Exosome [BR:eiv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EIN_412190   Exosomal proteins of other body fluids (saliva and urine)    EIN_412190   Exosomal proteins of colorectal cancer cells    EIN_412190   Exosomal proteins of bladder cancer cells    EIN_412190 GTP-binding proteins [BR:eiv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     EIN_412190 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Motif Other DBs NCBI-GeneID:  14894340 NCBI-ProteinID:  XP_004262131 UniProt:  A0A0A1UHH3 LinkDB All DBs Position Unknown AA seq 203 aa AA seqDB search MATPKNVKLVIVGDGAVGKTCILCSYTSGSFPTQYVPTVFENYNAITKVDNEEINLSLVD TAGQEEYDRLRHLSYPGCNCFLMCFSLISQGSLDNIEGKWKPEIDEYALGTPFLLIGTKA DLREDQDFLKKAKEENITIMDSSKGEEMTKKLGAKKYIECSALTQFNLKELFMEAAKVGL TYTPKMENEEENKKKDGKCCQLL NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggctacaccaaaaaacgttaaattggttatagtaggcgacggagctgttgggaagaca tgtatattatgttcatacacgagtgggtcctttccaacacaatacgttccaactgtcttt gaaaattacaacgctataaccaaagttgacaatgaagaaattaacttgtctttggtggat actgccgggcaagaagaatatgatcgactcagacatttatcataccccgggtgcaactgt tttttaatgtgtttttctttgatctcacaagggtctttagataacattgaagggaagtgg aaacccgaaatcgatgaatatgctttgggcactccatttctattgattggaacaaaagca gatcttcgagaagaccaagattttttgaagaaggcaaaggaagagaatatcactattatg gactcaagtaagggagaggaaatgaccaagaaacttggagctaaaaagtacattgaatgc tcggcactcactcagttcaatttaaaggaattgtttatggaagctgctaaagtcggcctt acatatacacccaaaatggaaaatgaggaagagaataaaaagaaagacggcaaatgttgc cagttactttaa

DBGET integrated database retrieval system