Entamoeba invadens: EIN_510720 Help Entry EIN_510720        CDS       T04133                                  Name (RefSeq) Rho GTPase, putative   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism eiv  Entamoeba invadens Pathway eiv04145   Phagosome eiv04148   Efferocytosis eiv04620   Toll-like receptor signaling pathway eiv05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:eiv00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     EIN_510720    04148 Efferocytosis     EIN_510720  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     EIN_510720  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     EIN_510720  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eiv04131]     EIN_510720   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eiv04147]     EIN_510720    04031 GTP-binding proteins [BR:eiv04031]     EIN_510720 Membrane trafficking [BR:eiv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     EIN_510720  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     EIN_510720   Macropinocytosis    Ras GTPases     EIN_510720  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     EIN_510720 Exosome [BR:eiv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    EIN_510720   Exosomal proteins of other body fluids (saliva and urine)    EIN_510720   Exosomal proteins of colorectal cancer cells    EIN_510720   Exosomal proteins of bladder cancer cells    EIN_510720 GTP-binding proteins [BR:eiv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     EIN_510720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf AAA_14 Motif Other DBs NCBI-GeneID:  14883116 NCBI-ProteinID:  XP_004183486 UniProt:  L7FJN6 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MGWENTFKIVVNGMDTVGKSCLLHRYANQYFPDPQLPAVFDDDIRQMTYKDMTIKQVLKE TYGNEGYPLIRPLCYLNTTCFVLCFSLVDQTSFDEIETIWIPEIKKNNQTTPIILVGTKS DLRDTKMVNRDNKSIQTENGIRLATEIGAMKYIECSALTNYNIDLVFEEAKKESAIFIGI NPQITKCIVC NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggggtgggaaaatacgttcaaaattgtagtcaatggaatggacactgttggaaagtct tgtcttttgcatcgttatgcaaaccaatattttcccgatccacaacttcctgctgttttt gatgatgatataaggcagatgacttataaggacatgactatcaaacaagtattgaaagaa acttatggcaacgagggttaccctcttatccgtccactgtgttatttaaatactacatgt tttgttctatgtttttctctggtagatcaaacatcttttgatgaaatagaaaccatctgg ataccagaaattaaaaagaataaccagaccactccaataatacttgtgggcaccaaaagt gacttaagagacacaaaaatggtaaatagagacaacaaatcaattcaaacagaaaatgga attagactggcaacagagatcggagcaatgaaatatattgaatgctcagcacttacaaat tacaacattgacctggtcttcgaagaagctaaaaaagaaagtgctatatttattggaatc aatcctcaaataacaaagtgcattgtctgttaa

DBGET integrated database retrieval system