Embiotoca jacksoni (black perch): 138194062 Help Entry 138194062         CDS       T10523                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism eja  Embiotoca jacksoni (black perch) Pathway eja04010   MAPK signaling pathway eja04144   Endocytosis eja04370   VEGF signaling pathway eja04510   Focal adhesion eja04520   Adherens junction eja04530   Tight junction eja04810   Regulation of actin cytoskeleton eja04912   GnRH signaling pathway eja05100   Bacterial invasion of epithelial cells eja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eja00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     138194062 (cdc42l)    04370 VEGF signaling pathway     138194062 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     138194062 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     138194062 (cdc42l)    04520 Adherens junction     138194062 (cdc42l)    04530 Tight junction     138194062 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     138194062 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     138194062 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138194062 (cdc42l)    05100 Bacterial invasion of epithelial cells     138194062 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eja04131]     138194062 (cdc42l)    03036 Chromosome and associated proteins [BR:eja03036]     138194062 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eja04147]     138194062 (cdc42l)    04031 GTP-binding proteins [BR:eja04031]     138194062 (cdc42l) Membrane trafficking [BR:eja04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     138194062 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     138194062 (cdc42l)   Macropinocytosis    Ras GTPases     138194062 (cdc42l) Chromosome and associated proteins [BR:eja03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     138194062 (cdc42l) Exosome [BR:eja04147]  Exosomal proteins   Exosomal proteins of microglial cells    138194062 (cdc42l)   Exosomal proteins of breast milk    138194062 (cdc42l) GTP-binding proteins [BR:eja04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     138194062 (cdc42l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  138194062 NCBI-ProteinID:  XP_068998575 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPSTPFLLVGTQVDLR EDSNTIEKLAKNKQRPLHPESGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgcgtagtggtaggagacggtgcagtcggaaagacctgcttactg atctcctacacaaccaacaagttcccctcagaatatgtgcctacggtttttgacaattat gcagtgacggtgatgatcggaggagagccttacacacttggtctttttgacacagcaggt caggaggattatgacaggctgcgtcctctcagctacccgcaaacagacgtgttcctcgta tgtttctctgtcgtctccccctcgtcgtttgagaacgtcaaagagaagtgggttcctgag atttcccaccactgcccaagcacacccttcctgttggtggggacacaggtggacctgcgg gaagacagcaacacaatcgagaagctggcaaagaacaaacagcgccccttacacccggag agtggggagaagctggctcgtgagctccgggctgtaaaatatgtggagtgctctgcactc acacagcgaggacttaagaacgtgtttgacgaggccatactggcagccttggagcctcct gagaccaaaaccaagaggaagtgtgttcttctatag

DBGET integrated database retrieval system