Embiotoca jacksoni (black perch): 138196500 Help Entry 138196500         CDS       T10523                                  Symbol h2ax Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism eja  Embiotoca jacksoni (black perch) Pathway eja03082   ATP-dependent chromatin remodeling eja04217   Necroptosis Brite KEGG Orthology (KO) [BR:eja00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     138196500 (h2ax)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     138196500 (h2ax)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eja03036]     138196500 (h2ax)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eja04147]     138196500 (h2ax) Chromosome and associated proteins [BR:eja03036]  Eukaryotic type   Nucleosome assembly factors    Histones     138196500 (h2ax) Exosome [BR:eja04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    138196500 (h2ax) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  138196500 NCBI-ProteinID:  XP_069002703 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MSGRGKTGAKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TGQSAPSSGKAGKKASSQSQEY NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagaggcaaaaccggagcaaaggcccgcgctaaggccaagacccgtagctcc cgcgccggtctgcagttccccgtaggccgcgttcaccgtctcctccgcaaaggtaactac gccgagagagtgggcgccggggcccccgtgtatctggccgctgtcctcgagtacctcacc gccgagatcctggagttggccggcaacgccgccagggacaacaagaagacccgcatcatc cctcgccacctgcagctggccgtgcgcaacgacgaggagctgaacaaactgctcggcggc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtcctgctgcccaagaag accggccagtcggcaccgagctccggcaaggcgggaaagaaggcctcctctcaatctcag gagtattag

DBGET integrated database retrieval system