Embiotoca jacksoni (black perch): 138201003 Help Entry 138201003         CDS       T10523                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism eja  Embiotoca jacksoni (black perch) Pathway eja04814   Motor proteins eja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eja00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     138201003 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138201003 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:eja03037]     138201003 (dynlt3)    04812 Cytoskeleton proteins [BR:eja04812]     138201003 (dynlt3) Cilium and associated proteins [BR:eja03037]  Motile cilia and associated proteins   Dynein arm    138201003 (dynlt3) Cytoskeleton proteins [BR:eja04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      138201003 (dynlt3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  138201003 NCBI-ProteinID:  XP_069010172 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MEEYNPADEVVFNVDESTFSIKECIESVIGGTDYNQGKVNQWTAGIVEHSLTHLVKQGRP FKYIVNCTIMQKSGAGLHTANSCYWDTATDGSCTVRWENRTMYCVVSVFAVAVAL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtacaatcccgcagacgaggtcgtcttcaacgtcgatgagagcactttctcc attaaagagtgtatcgaaagcgtcatcgggggaacggattacaaccagggcaaagtgaac cagtggacggccggcattgtggagcattcactgactcacctcgtcaaacagggacggccg ttcaaatacatcgtgaactgtaccatcatgcagaagagcggcgctggtctccacacggcc aactcctgctactgggacacggccactgacggaagctgcaccgtcaggtgggagaaccgc accatgtactgcgtggtcagcgtgtttgctgttgctgtggcgctgtga

DBGET integrated database retrieval system