Embiotoca jacksoni (black perch): 138202008 Help Entry 138202008         CDS       T10523                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism eja  Embiotoca jacksoni (black perch) Pathway eja04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:eja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     138202008  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:eja04121]     138202008    03400 DNA repair and recombination proteins [BR:eja03400]     138202008 Ubiquitin system [BR:eja04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      138202008    Cul5 complex      138202008 DNA repair and recombination proteins [BR:eja03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      138202008 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  138202008 NCBI-ProteinID:  XP_069011755 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRVNDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacgatcttcacagatgccaaggag tccaccaccgtctacgagctgaagcgtattgttgaaggaatacttaaaagaccacccgag gaccagcggctttacaaagatgatcagttgctagaggacagcaaaactctgggtgactct ggattcaccaaccagactgccagacctcaagccccagctacagtgggtctggccttccgt gtaaatgatgagatgttcgagcagctgcacattgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactctggtagcactgccaatgagcagtcagtgcagtga

DBGET integrated database retrieval system