Embiotoca jacksoni (black perch): 138205989 Help Entry 138205989         CDS       T10523                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism eja  Embiotoca jacksoni (black perch) Pathway eja04010   MAPK signaling pathway eja04012   ErbB signaling pathway eja04068   FoxO signaling pathway eja04137   Mitophagy - animal eja04140   Autophagy - animal eja04144   Endocytosis eja04150   mTOR signaling pathway eja04210   Apoptosis eja04218   Cellular senescence eja04370   VEGF signaling pathway eja04371   Apelin signaling pathway eja04510   Focal adhesion eja04540   Gap junction eja04625   C-type lectin receptor signaling pathway eja04810   Regulation of actin cytoskeleton eja04910   Insulin signaling pathway eja04912   GnRH signaling pathway eja04916   Melanogenesis eja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eja00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     138205989    04012 ErbB signaling pathway     138205989    04370 VEGF signaling pathway     138205989    04371 Apelin signaling pathway     138205989    04068 FoxO signaling pathway     138205989    04150 mTOR signaling pathway     138205989  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     138205989    04140 Autophagy - animal     138205989    04137 Mitophagy - animal     138205989   09143 Cell growth and death    04210 Apoptosis     138205989    04218 Cellular senescence     138205989   09144 Cellular community - eukaryotes    04510 Focal adhesion     138205989    04540 Gap junction     138205989   09142 Cell motility    04810 Regulation of actin cytoskeleton     138205989  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     138205989   09152 Endocrine system    04910 Insulin signaling pathway     138205989    04912 GnRH signaling pathway     138205989    04916 Melanogenesis     138205989  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138205989  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eja04131]     138205989   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eja04147]     138205989    04031 GTP-binding proteins [BR:eja04031]     138205989 Membrane trafficking [BR:eja04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     138205989  Endocytosis   Macropinocytosis    Ras GTPases     138205989 Exosome [BR:eja04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    138205989   Exosomal proteins of colorectal cancer cells    138205989 GTP-binding proteins [BR:eja04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     138205989 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  138205989 NCBI-ProteinID:  XP_069018498 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtagttggagctggaggcgttggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccactatagaggactcgtac aggaagcaggtggtgatcgacggggagacctgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggagggcttcctctgc gtcttcgccatcaacaacaccaagtcctttgaggacattcaccagtacagagaacagatt aagcgagtgaaggactcggatgacgttcccatggtgcttgtgggaaacaaatgtgacctc ccggcacgcacagtggacacaaggcaagcccaggaactagctcgctcctatggcatccca tacatcgagacctctgccaaaacacgacagggagtagaggacgccttctacacactggtt agggagatcagacagcataaactgaggaagctgaacccgcccgatgagagtggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system