Embiotoca jacksoni (black perch): 138210550 Help Entry 138210550         CDS       T10523                                  Symbol txnb Name (RefSeq) thioredoxin b   KO K03671   thioredoxin Organism eja  Embiotoca jacksoni (black perch) Pathway eja04621   NOD-like receptor signaling pathway eja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eja00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     138210550 (txnb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138210550 (txnb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:eja03110]     138210550 (txnb) Chaperones and folding catalysts [BR:eja03110]  Protein folding catalysts   Protein disulfide isomerase    138210550 (txnb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin AhpC-TSA Thioredoxin_8 OST3_OST6 Redoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_9 DIM1 DUF5685 BrxC DUF6461 CM2 Motif Other DBs NCBI-GeneID:  138210550 NCBI-ProteinID:  XP_069025873 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MVHEVESLEEFKAILKDSGTKLVVVDFTATWCGPCKQIAPEYTKLSEKPENKDVVFLKVD VDEAEDVSSFSEVKCMPTFHFYKNGEKVFEFSGANLTLLKEKVESLR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggttcacgaggtggaaagtttggaggagttcaaggccatcctgaaggattcagggacc aagctggtggtggtggacttcacggccacgtggtgtggcccctgcaaacagatcgcccca gaatatacgaaactgtcagaaaagcctgagaacaaggacgtggtcttcctgaaggtggac gtagatgaagctgaggatgtcagttctttcagtgaagtcaaatgcatgcccacattccac ttctacaagaatggagagaaagtgttcgagttctctggcgctaacctcaccctactcaaa gaaaaagtggaatctctgagataa

DBGET integrated database retrieval system