Embiotoca jacksoni (black perch): 138214991 Help Entry 138214991         CDS       T10523                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism eja  Embiotoca jacksoni (black perch) Pathway eja04382   Cornified envelope formation eja05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eja00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     138214991  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     138214991  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eja04147]     138214991 Exosome [BR:eja04147]  Exosomal proteins   Exosomal proteins of microglial cells    138214991 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EH CRISPR_Cas9_WED Motif Other DBs NCBI-GeneID:  138214991 NCBI-ProteinID:  XP_069033000 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSELERAMESLIKVFHCYSKDDKTLCHKEFKKLMETELSGFLKSQKDPSTVDRIMKDLD TNGDGKVDFEGFVSLVVGLSNACEQCYQMHRKKTAKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagagagccatggagtctctcattaaggtcttccactgttactct aaggatgataagacactctgccacaaagagttcaaaaagttgatggagactgagctgtct ggcttccttaagtcccagaaggacccttcaactgtggacaggatcatgaaggacttggac accaacggtgatggcaaagtagactttgaggggtttgtttctctggttgttggactttca aatgcctgtgagcagtgctatcagatgcacaggaagaagacggcgaagaagtaa

DBGET integrated database retrieval system