KEGG   Eumetopias jubatus (Steller sea lion): 114197118
Entry
114197118         CDS       T07240                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju04014  Ras signaling pathway
eju04015  Rap1 signaling pathway
eju04020  Calcium signaling pathway
eju04022  cGMP-PKG signaling pathway
eju04024  cAMP signaling pathway
eju04070  Phosphatidylinositol signaling system
eju04114  Oocyte meiosis
eju04218  Cellular senescence
eju04261  Adrenergic signaling in cardiomyocytes
eju04270  Vascular smooth muscle contraction
eju04371  Apelin signaling pathway
eju04625  C-type lectin receptor signaling pathway
eju04713  Circadian entrainment
eju04720  Long-term potentiation
eju04722  Neurotrophin signaling pathway
eju04728  Dopaminergic synapse
eju04740  Olfactory transduction
eju04744  Phototransduction
eju04750  Inflammatory mediator regulation of TRP channels
eju04910  Insulin signaling pathway
eju04912  GnRH signaling pathway
eju04915  Estrogen signaling pathway
eju04916  Melanogenesis
eju04921  Oxytocin signaling pathway
eju04922  Glucagon signaling pathway
eju04924  Renin secretion
eju04925  Aldosterone synthesis and secretion
eju04970  Salivary secretion
eju04971  Gastric acid secretion
eju05010  Alzheimer disease
eju05012  Parkinson disease
eju05022  Pathways of neurodegeneration - multiple diseases
eju05031  Amphetamine addiction
eju05034  Alcoholism
eju05133  Pertussis
eju05152  Tuberculosis
eju05163  Human cytomegalovirus infection
eju05167  Kaposi sarcoma-associated herpesvirus infection
eju05170  Human immunodeficiency virus 1 infection
eju05200  Pathways in cancer
eju05214  Glioma
eju05417  Lipid and atherosclerosis
eju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    114197118
   04015 Rap1 signaling pathway
    114197118
   04371 Apelin signaling pathway
    114197118
   04020 Calcium signaling pathway
    114197118
   04070 Phosphatidylinositol signaling system
    114197118
   04024 cAMP signaling pathway
    114197118
   04022 cGMP-PKG signaling pathway
    114197118
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114197118
   04218 Cellular senescence
    114197118
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114197118
  09152 Endocrine system
   04910 Insulin signaling pathway
    114197118
   04922 Glucagon signaling pathway
    114197118
   04912 GnRH signaling pathway
    114197118
   04915 Estrogen signaling pathway
    114197118
   04921 Oxytocin signaling pathway
    114197118
   04916 Melanogenesis
    114197118
   04924 Renin secretion
    114197118
   04925 Aldosterone synthesis and secretion
    114197118
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114197118
   04270 Vascular smooth muscle contraction
    114197118
  09154 Digestive system
   04970 Salivary secretion
    114197118
   04971 Gastric acid secretion
    114197118
  09156 Nervous system
   04728 Dopaminergic synapse
    114197118
   04720 Long-term potentiation
    114197118
   04722 Neurotrophin signaling pathway
    114197118
  09157 Sensory system
   04744 Phototransduction
    114197118
   04740 Olfactory transduction
    114197118
   04750 Inflammatory mediator regulation of TRP channels
    114197118
  09159 Environmental adaptation
   04713 Circadian entrainment
    114197118
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114197118
  09162 Cancer: specific types
   05214 Glioma
    114197118
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114197118
   05163 Human cytomegalovirus infection
    114197118
   05167 Kaposi sarcoma-associated herpesvirus infection
    114197118
  09171 Infectious disease: bacterial
   05133 Pertussis
    114197118
   05152 Tuberculosis
    114197118
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114197118
   05012 Parkinson disease
    114197118
   05022 Pathways of neurodegeneration - multiple diseases
    114197118
  09165 Substance dependence
   05031 Amphetamine addiction
    114197118
   05034 Alcoholism
    114197118
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114197118
   05418 Fluid shear stress and atherosclerosis
    114197118
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eju01009]
    114197118
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eju04131]
    114197118
   03036 Chromosome and associated proteins [BR:eju03036]
    114197118
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eju04147]
    114197118
Protein phosphatases and associated proteins [BR:eju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     114197118
Membrane trafficking [BR:eju04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    114197118
Chromosome and associated proteins [BR:eju03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     114197118
Exosome [BR:eju04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   114197118
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 Dockerin_1 EFhand_Ca_insen Caleosin UPF0154 DUF1103 FCaBP_EF-hand TerB Fe_hyd_lg_C DUF5580_M SurA_N_3 MecA_N PA_Ig-like
Other DBs
NCBI-GeneID: 114197118
NCBI-ProteinID: XP_027943810
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTEELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMTRKMKDTDSEEEIREAFHVFDKDGNGYISAAELCHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccaactgactgaagagcagattgcagaattcaaagaagctttttcactattt
gacaaggatggtgatggaactataacaacagaggaattgggaactgtaatgaggtctctt
gggcaaaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt
aatggcacaattgacttcccggaatttctgacaatgatgacaagaaaaatgaaagacaca
gacagtgaagaagaaattagagaagcattccatgtgtttgataaggatggtaatggctat
attagtgcagcagagctttgccatgtgatgacaaacctgggagagaagttaacagatgaa
gaggttgatgaaatgatcagggaagcagatattgatggtgatggccaagtaaactatgaa
gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system