Eumetopias jubatus (Steller sea lion): 114197118 Help Entry 114197118         CDS       T07240                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04014   Ras signaling pathway eju04015   Rap1 signaling pathway eju04020   Calcium signaling pathway eju04022   cGMP-PKG signaling pathway eju04024   cAMP signaling pathway eju04070   Phosphatidylinositol signaling system eju04114   Oocyte meiosis eju04218   Cellular senescence eju04261   Adrenergic signaling in cardiomyocytes eju04270   Vascular smooth muscle contraction eju04371   Apelin signaling pathway eju04625   C-type lectin receptor signaling pathway eju04713   Circadian entrainment eju04720   Long-term potentiation eju04722   Neurotrophin signaling pathway eju04728   Dopaminergic synapse eju04740   Olfactory transduction eju04744   Phototransduction eju04750   Inflammatory mediator regulation of TRP channels eju04910   Insulin signaling pathway eju04912   GnRH signaling pathway eju04915   Estrogen signaling pathway eju04916   Melanogenesis eju04921   Oxytocin signaling pathway eju04922   Glucagon signaling pathway eju04924   Renin secretion eju04925   Aldosterone synthesis and secretion eju04970   Salivary secretion eju04971   Gastric acid secretion eju05010   Alzheimer disease eju05012   Parkinson disease eju05022   Pathways of neurodegeneration - multiple diseases eju05031   Amphetamine addiction eju05034   Alcoholism eju05133   Pertussis eju05152   Tuberculosis eju05163   Human cytomegalovirus infection eju05167   Kaposi sarcoma-associated herpesvirus infection eju05170   Human immunodeficiency virus 1 infection eju05200   Pathways in cancer eju05214   Glioma eju05417   Lipid and atherosclerosis eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     114197118    04015 Rap1 signaling pathway     114197118    04371 Apelin signaling pathway     114197118    04020 Calcium signaling pathway     114197118    04070 Phosphatidylinositol signaling system     114197118    04024 cAMP signaling pathway     114197118    04022 cGMP-PKG signaling pathway     114197118  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     114197118    04218 Cellular senescence     114197118  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114197118   09152 Endocrine system    04910 Insulin signaling pathway     114197118    04922 Glucagon signaling pathway     114197118    04912 GnRH signaling pathway     114197118    04915 Estrogen signaling pathway     114197118    04921 Oxytocin signaling pathway     114197118    04916 Melanogenesis     114197118    04924 Renin secretion     114197118    04925 Aldosterone synthesis and secretion     114197118   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     114197118    04270 Vascular smooth muscle contraction     114197118   09154 Digestive system    04970 Salivary secretion     114197118    04971 Gastric acid secretion     114197118   09156 Nervous system    04728 Dopaminergic synapse     114197118    04720 Long-term potentiation     114197118    04722 Neurotrophin signaling pathway     114197118   09157 Sensory system    04744 Phototransduction     114197118    04740 Olfactory transduction     114197118    04750 Inflammatory mediator regulation of TRP channels     114197118   09159 Environmental adaptation    04713 Circadian entrainment     114197118  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114197118   09162 Cancer: specific types    05214 Glioma     114197118   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     114197118    05163 Human cytomegalovirus infection     114197118    05167 Kaposi sarcoma-associated herpesvirus infection     114197118   09171 Infectious disease: bacterial    05133 Pertussis     114197118    05152 Tuberculosis     114197118   09164 Neurodegenerative disease    05010 Alzheimer disease     114197118    05012 Parkinson disease     114197118    05022 Pathways of neurodegeneration - multiple diseases     114197118   09165 Substance dependence    05031 Amphetamine addiction     114197118    05034 Alcoholism     114197118   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114197118    05418 Fluid shear stress and atherosclerosis     114197118  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:eju01009]     114197118   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eju04131]     114197118    03036 Chromosome and associated proteins [BR:eju03036]     114197118   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eju04147]     114197118 Protein phosphatases and associated proteins [BR:eju01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114197118 Membrane trafficking [BR:eju04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114197118 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114197118 Exosome [BR:eju04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114197118 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 Dockerin_1 EFhand_Ca_insen Caleosin UPF0154 DUF1103 FCaBP_EF-hand TerB Fe_hyd_lg_C DUF5580_M SurA_N_3 MecA_N PA_Ig-like Motif Other DBs NCBI-GeneID:  114197118 NCBI-ProteinID:  XP_027943810 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTEELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMTRKMKDTDSEEEIREAFHVFDKDGNGYISAAELCHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaactgactgaagagcagattgcagaattcaaagaagctttttcactattt gacaaggatggtgatggaactataacaacagaggaattgggaactgtaatgaggtctctt gggcaaaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt aatggcacaattgacttcccggaatttctgacaatgatgacaagaaaaatgaaagacaca gacagtgaagaagaaattagagaagcattccatgtgtttgataaggatggtaatggctat attagtgcagcagagctttgccatgtgatgacaaacctgggagagaagttaacagatgaa gaggttgatgaaatgatcagggaagcagatattgatggtgatggccaagtaaactatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system