Eumetopias jubatus (Steller sea lion): 114197356 Help Entry 114197356         CDS       T07240                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04613   Neutrophil extracellular trap formation eju05034   Alcoholism eju05203   Viral carcinogenesis eju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:eju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114197356  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     114197356   09163 Immune disease    05322 Systemic lupus erythematosus     114197356   09165 Substance dependence    05034 Alcoholism     114197356  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eju03036]     114197356 Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114197356 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  114197356 NCBI-ProteinID:  XP_027944183 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaagaggtaagggtggcaagggcttgggtaagggtggtgctaaacgccaccgc aaagtcttgagggataacatccaaggcattactaagccggccatccgacgcctcgctcgg cgtggaggagtcaagcggatctccggcctcatttacgaggagactcgcggtgtgctcaag gtgttcttagagaacgtcattcgggacgcggtcacctacaccgagcacgccaagcgcaag acggttaccgctatggacgtggtgtatgccctcaagcgacagggacgcaccctgtatggc ttcggaggctaa

DBGET integrated database retrieval system