Eumetopias jubatus (Steller sea lion): 114199764 Help Entry 114199764         CDS       T07240                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04061   Viral protein interaction with cytokine and cytokine receptor eju04062   Chemokine signaling pathway eju04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114199764 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     114199764 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114199764 (CCL22)    04062 Chemokine signaling pathway     114199764 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114199764 (CCL22) Cytokines and neuropeptides [BR:eju04052]  Cytokines   Chemokines    114199764 (CCL22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  114199764 NCBI-ProteinID:  XP_027947561 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLKTPLLAALVFLALTLQATEAGPYGANVEDSICCRDYFRHPLPPRMLKFFYWTSDSC RRPGVVFLTVKDREICADPRMPWVKKILQKLDS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagaccccgctcctggctgcccttgtctttcttgctctgacacttcaa gcaactgaggcaggtccttatggcgccaacgtggaagacagtatctgttgccgggactac ttccgtcaccctctgcctccgcgcatgctgaagtttttctactggacctcagactcgtgc cggaggcctggcgtggtcttcctaactgtcaaggaccgggagatctgtgctgaccccaga atgccctgggtgaagaagattctccagaaactggactcatga

DBGET integrated database retrieval system