Eumetopias jubatus (Steller sea lion): 114200041 Help Entry 114200041         CDS       T07240                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism eju  Eumetopias jubatus (Steller sea lion) Brite KEGG Orthology (KO) [BR:eju00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:eju03037]     114200041 (BBIP1) Cilium and associated proteins [BR:eju03037]  Primary cilia and associated proteins   BBSome    114200041 (BBIP1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  114200041 NCBI-ProteinID:  XP_027947808 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MAEVKSMFREVLPKQGQLSVEDITTMVLCKPKLLPLKSLTLEKLEKMQQAAQDTIRQQEM AEKEQQQITH NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcggaagtgaagtcaatgtttcgggaagttcttccaaaacaagggcagttgtcagtg gaagatataaccacaatggtgctgtgtaaacccaaacttttgcccttaaaatctctgact ctggaaaaactggagaaaatgcagcaagcagcccaggatacgattcgccaacaagaaatg gcagaaaaggaacaacagcaaataactcactga

DBGET integrated database retrieval system