Eumetopias jubatus (Steller sea lion): 114200553 Help Entry 114200553         CDS       T07240                                  Symbol PPY Name (RefSeq) pancreatic prohormone   KO K05234   pancreatic polypeptide Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     114200553 (PPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114200553 (PPY) Cytokines and neuropeptides [BR:eju04052]  Neuropeptides   GPCR binding    114200553 (PPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  114200553 NCBI-ProteinID:  XP_027948518 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MPAARHFLSLLLLPTCVALWLPPPRGARGAPLEPVYPGDKATPEQMAQYAAELRRYINML TRPRYGKRDREQTLDILEWGSPRTAAPRELSPMDL NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcccgccgcccgccacttcctctccctgctgctcctgcccacctgcgtggctctgtgg ctgccaccgccgcggggggcccggggggccccgctggagccagtgtaccctggggacaag gccacgccagagcagatggcccagtatgcggctgagctccgcagatacatcaacatgctg accaggcccaggtacgggaagagagacagagaacaaacgctggacatcctggagtggggc tccccccgcactgctgcccccagggagctcagcccgatggacttgtaa

DBGET integrated database retrieval system